PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.53
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 212aa    MW: 24594 Da    PI: 9.4625
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.53genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR197.31.7e-3041129291
                        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtklele 84 
                                 fY++YA+++GF +r+++ ++s r+g++++r++vC+keg+r+ + ++ +++r++ra tr gCka+++vkk+k+gkw+vt++++e
  evm.model.supercontig_8.53  41 FYDAYATRLGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR-SENRKPRAITREGCKAMIVVKKDKSGKWVVTRFVKE 122
                                 9*******************************************99.9*********************************** PP

                        FAR1  85 HnHelap 91 
                                 HnH+l+p
  evm.model.supercontig_8.53 123 HNHQLVP 129
                                 *****86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.8E-2941129IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAEDGEMIES SNGKGLANEE CSDMEPYQGM EFESEEAAKV FYDAYATRLG FIMRVDAFRR  60
SMRDGKVVWR RLVCNKEGFR KLRPRRSENR KPRAITREGC KAMIVVKKDK SGKWVVTRFV  120
KEHNHQLVPI PANGRRSIVL SQTPDEKDIK IRELTAELQR ERKRCAAYQE QLDSILRDME  180
EHSDHLTRNI DDIVQSVREI ESKRVANPHS K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010646071.11e-131PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010646680.11e-131PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL81e-34FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLF6I1W91e-130F6I1W9_VITVI; Putative uncharacterized protein
STRINGVIT_00s0174g00120.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135242227
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.11e-96FAR1 family protein